Recombinant Mouse Gstm1 protein, His-tagged
| Cat.No. : | Gstm1-6443M |
| Product Overview : | Recombinant Mouse Gstm1 protein(P10649)(2-218aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-218aa |
| Tag : | N-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | PMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK |
| Gene Name | Gstm1 glutathione S-transferase, mu 1 [ Mus musculus ] |
| Official Symbol | Gstm1 |
| Synonyms | GSTM1; glutathione S-transferase, mu 1; glutathione S-transferase Mu 1; pmGT10; GST 1-1; GST class-mu 1; glutathione S-transferase GT8.7; glutathione-S-transferase, mu 1; Gstb1; Gstb-1; |
| Gene ID | 14862 |
| mRNA Refseq | NM_010358 |
| Protein Refseq | NP_034488 |
| ◆ Recombinant Proteins | ||
| GSTM1-2451H | Recombinant Human GSTM1 Protein (Met1-Lys181), N-His tagged | +Inquiry |
| GSTM1-2386R | Recombinant Rat GSTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSTM1-7496H | Recombinant Human GSTM1 protein, His-tagged | +Inquiry |
| GSTM1-907H | Recombinant Human GSTM1 Protein, His-tagged | +Inquiry |
| GSTM1-5115H | Recombinant Human GSTM1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gstm1 Products
Required fields are marked with *
My Review for All Gstm1 Products
Required fields are marked with *



