Recombinant Mouse Gstm3 protein, His&Myc-tagged
Cat.No. : | Gstm3-675M |
Product Overview : | Recombinant Mouse Gstm3 protein(P19639)(2-218aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-218aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIQLMIVCCSPDFEKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWGTD |
Gene Name | Gstm3 glutathione S-transferase, mu 3 [ Mus musculus ] |
Official Symbol | Gstm3 |
Synonyms | GSTM3; glutathione S-transferase, mu 3; glutathione S-transferase Mu 3; GST class-mu 3; glutathione S-transferase GT9.3; Fsc2; mGSTM5; |
Gene ID | 14864 |
mRNA Refseq | NM_010359 |
Protein Refseq | NP_034489 |
◆ Recombinant Proteins | ||
GSTM3-322C | Recombinant Cynomolgus Monkey GSTM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTM3-7332M | Recombinant Mouse GSTM3 Protein | +Inquiry |
Gstm3-675M | Recombinant Mouse Gstm3 protein, His&Myc-tagged | +Inquiry |
GSTM3-3974M | Recombinant Mouse GSTM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTM3-1993R | Recombinant Rhesus monkey GSTM3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTM3-759HCL | Recombinant Human GSTM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gstm3 Products
Required fields are marked with *
My Review for All Gstm3 Products
Required fields are marked with *
0
Inquiry Basket