Recombinant Mouse GUCA2B Protein (22-106 aa), His-tagged

Cat.No. : GUCA2B-1407M
Product Overview : Recombinant Mouse GUCA2B Protein (22-106 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 22-106 aa
Description : Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.4 kDa
AA Sequence : VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Guca2b guanylate cyclase activator 2b (retina) [ Mus musculus ]
Official Symbol GUCA2B
Synonyms GUCA2B; uroguanylin; Ugn; Gcap2; AV066530;
Gene ID 14916
mRNA Refseq NM_008191
Protein Refseq NP_032217
UniProt ID O09051

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCA2B Products

Required fields are marked with *

My Review for All GUCA2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon