Recombinant Mouse GUCA2B Protein (22-106 aa), His-tagged

• Cat.No.: GUCA2B-1407M
• Product Overview: Recombinant Mouse GUCA2B Protein (22-106 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 22-106 aa
• Description: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.4 kDa
• AA Sequence: VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Guca2b guanylate cyclase activator 2b (retina) [ Mus musculus ]
• Official Symbol: GUCA2B
• Synonyms: GUCA2B; uroguanylin; Ugn; Gcap2; AV066530
• Gene ID: 14916
• mRNA Refseq: NM_008191
• Protein Refseq: NP_032217
• UniProt ID: O09051