Recombinant Mouse Gzmk protein, His-tagged
Cat.No. : | Gzmk-3533M |
Product Overview : | Recombinant Mouse Gzmk protein(O35205)(26-263aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect cells |
Tag : | His |
Protein Length : | 26-263aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | IIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAPSRAH |
Gene Name | Gzmk granzyme K [ Mus musculus ] |
Official Symbol | Gzmk |
Synonyms | GZMK; granzyme K; |
Gene ID | 14945 |
mRNA Refseq | NM_008196 |
Protein Refseq | NP_032222 |
◆ Recombinant Proteins | ||
GZMK-3067H | Recombinant Human GZMK protein(Ile27~Asn264), His-tagged | +Inquiry |
Gzmk-3533M | Recombinant Mouse Gzmk protein, His-tagged | +Inquiry |
Gzmk-5812M | Recombinant Mouse Gzmk protein(Gln44~Val227), His-tagged | +Inquiry |
GZMK-3391HF | Recombinant Full Length Human GZMK Protein, GST-tagged | +Inquiry |
GZMK-140H | Recombinant Human GZMK protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMK-5667HCL | Recombinant Human GZMK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gzmk Products
Required fields are marked with *
My Review for All Gzmk Products
Required fields are marked with *
0
Inquiry Basket