Recombinant Mouse HADHA Protein (348-763 aa), His-Myc-tagged
Cat.No. : | HADHA-2613M |
Product Overview : | Recombinant Mouse HADHA Protein (348-763 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 348-763 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 52.1 kDa |
AA Sequence : | LCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Hadha hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit [ Mus musculus ] |
Official Symbol | HADHA |
Synonyms | HADHA; trifunctional enzyme subunit alpha, mitochondrial; TP-alpha; Mtpa; C77020; |
Gene ID | 97212 |
mRNA Refseq | NM_178878 |
Protein Refseq | NP_849209 |
UniProt ID | Q8BMS1 |
◆ Recombinant Proteins | ||
HADHA-2613M | Recombinant Mouse HADHA Protein (348-763 aa), His-Myc-tagged | +Inquiry |
HADHA-6613C | Recombinant Chicken HADHA | +Inquiry |
HADHA-1854R | Recombinant Rhesus Macaque HADHA Protein, His (Fc)-Avi-tagged | +Inquiry |
HADHA-13658H | Recombinant Human HADHA, GST-tagged | +Inquiry |
HADHA-2774M | Recombinant Mouse HADHA Protein (348-763 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HADHA-2120HCL | Recombinant Human HADHA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HADHA Products
Required fields are marked with *
My Review for All HADHA Products
Required fields are marked with *