Recombinant Mouse HADHA Protein (348-763 aa), His-Myc-tagged
| Cat.No. : | HADHA-2613M |
| Product Overview : | Recombinant Mouse HADHA Protein (348-763 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 348-763 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 52.1 kDa |
| AA Sequence : | LCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Hadha hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit [ Mus musculus ] |
| Official Symbol | HADHA |
| Synonyms | HADHA; trifunctional enzyme subunit alpha, mitochondrial; TP-alpha; Mtpa; C77020; |
| Gene ID | 97212 |
| mRNA Refseq | NM_178878 |
| Protein Refseq | NP_849209 |
| UniProt ID | Q8BMS1 |
| ◆ Recombinant Proteins | ||
| HADHA-13658H | Recombinant Human HADHA, GST-tagged | +Inquiry |
| HADHA-2613M | Recombinant Mouse HADHA Protein (348-763 aa), His-Myc-tagged | +Inquiry |
| HADHA-2436R | Recombinant Rat HADHA Protein, His (Fc)-Avi-tagged | +Inquiry |
| HADHA-2782R | Recombinant Rat HADHA Protein | +Inquiry |
| HADHA-6613C | Recombinant Chicken HADHA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HADHA-2120HCL | Recombinant Human HADHA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HADHA Products
Required fields are marked with *
My Review for All HADHA Products
Required fields are marked with *
