Recombinant Mouse HAO1, without tag

• Cat.No.: HAO1-839M
• Product Overview: Recombinant Mouse Hydroxyacid oxidase 1 (HAOX1) (a.a.1-370) was expressed in E.coli with no tag.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 1-370 a.a.
• Form: Liquid
• Molecular Mass: Theoretical molecular weight: ~41kDa
• AA Sequence: MLPRLVCISDYEQHVRSVLQKSVYDYYRSGANDQETLADNIQAFSRWKLYPRMLRNVADIDLSTSVLGQRVSMPI CVGATAMQCMAHVDGELATVRACQTMGTGMMLSSWATSSIEEVAEAGPEALRWMQLYIYKDREISRQIVKRAEKQ GYKAIFVTVDTPYLGNRIDDVRNRFKLPPQLRMKNFETNDLAFSPKGNFGDNSGLAEYVAQAIDPSLSWDDITWL RRLTSLPIVVKGILRGDDAKEAVKHGVDGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV LKALALGAKAVFVGRPIIWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLVRKNPLAVSKI
• Purity: > 95% as determined by SDS-PAGE.
• Storage: Short Term Storage +4°C, Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
• Concentration: 2.5mg/ml
• Storage Buffer: 20mM Tris-HCl, pH8.0, 200mM NaCl, 10% Glycerol.

Gene Information

• Gene Name: Hao1 hydroxyacid oxidase 1, liver [ Mus musculus ]
• Official Symbol: HAO1
• Synonyms: HAO1; hydroxyacid oxidase 1, liver; hydroxyacid oxidase 1; HAOX1; glycolate oxidase 1; GOX; Gox1; Hao-1; MGC141211
• Gene ID: 15112
• mRNA Refseq: NM_010403
• Protein Refseq: NP_034533
• Pathway: Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Glyoxylate metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peroxisome, organism-specific biosystem
• Function: (S)-2-hydroxy-acid oxidase activity; (S)-2-hydroxy-acid oxidase activity; FMN binding; catalytic activity; glycolate oxidase activity; long-chain-(S)-2-hydroxy-long-chain-acid oxidase activity; medium-chain-(S)-2-hydroxy-acid oxidase activity; oxidoreductase activity; very-long-chain-(S)-2-hydroxy-acid oxidase activity