Recombinant Mouse Has2 protein, His-SUMO-tagged
Cat.No. : | Has2-3018M |
Product Overview : | Recombinant Mouse Has2 protein(P70312)(67-374aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 67-374aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
RFL20893XF | Recombinant Full Length Xenopus Laevis Hyaluronan Synthase 2(Has2) Protein, His-Tagged | +Inquiry |
HAS2-4060M | Recombinant Mouse HAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11122BF | Recombinant Full Length Bovine Hyaluronan Synthase 2(Has2) Protein, His-Tagged | +Inquiry |
HAS2-1409M | Recombinant Mouse HAS2 Protein (67-374 aa), His-tagged | +Inquiry |
HAS2-6369C | Recombinant Chicken HAS2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Has2 Products
Required fields are marked with *
My Review for All Has2 Products
Required fields are marked with *