Recombinant Mouse Has2 protein, His-SUMO-tagged
| Cat.No. : | Has2-3018M |
| Product Overview : | Recombinant Mouse Has2 protein(P70312)(67-374aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 67-374aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.9 kDa |
| AA Sequence : | EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| RFL16006HF | Recombinant Full Length Human Hyaluronan Synthase 2(Has2) Protein, His-Tagged | +Inquiry |
| RFL11122BF | Recombinant Full Length Bovine Hyaluronan Synthase 2(Has2) Protein, His-Tagged | +Inquiry |
| HAS2-7486M | Recombinant Mouse HAS2 Protein | +Inquiry |
| HAS2-3382M | Recombinant Mouse HAS2 protein, His-tagged | +Inquiry |
| HAS2-2792R | Recombinant Rat HAS2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Has2 Products
Required fields are marked with *
My Review for All Has2 Products
Required fields are marked with *
