Recombinant Mouse HBA Protein (2-142 aa), His-tagged
Cat.No. : | HBA-1410M |
Product Overview : | Recombinant Mouse HBA Protein (2-142 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-142 aa |
Description : | Involved in oxygen transport from the lung to the various peripheral tissues. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.0 kDa |
AA Sequence : | VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Hba hemoglobin alpha chain complex [ Mus musculus (house mouse) ] |
Official Symbol | HBA |
Synonyms | Hba; Alpha-globin; Hemoglobin alpha chain; |
Gene ID | 15121 |
UniProt ID | P01942 |
◆ Recombinant Proteins | ||
Hba-a2-10HCL | Recombinant Mouse Hba-a2 overexpression lysate | +Inquiry |
HBA-A2-4070M | Recombinant Mouse HBA-A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hba-a2-461M | Recombinant Mouse Hba-a2 Protein, MYC/DDK-tagged | +Inquiry |
Hba-7860M | Recombinant Mouse Hba protein, His & T7-tagged | +Inquiry |
Hba-3020M | Recombinant Mouse Hba protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hba-a2 Products
Required fields are marked with *
My Review for All Hba-a2 Products
Required fields are marked with *