Recombinant Mouse Hist1h2ba protein, His&Myc-tagged
Cat.No. : | Hist1h2ba-3030M |
Product Overview : | Recombinant Mouse Hist1h2ba protein(P70696)(2-127aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-127aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Hist1h2ba histone cluster 1, H2ba [ Mus musculus ] |
Official Symbol | Hist1h2ba |
Synonyms | HIST1H2BA; histone cluster 1, H2ba; histone H2B type 1-A; histone 1, H2ba; histone H2B, testis; testis-specific histone H2B; Th2b; |
Gene ID | 319177 |
mRNA Refseq | NM_175663 |
Protein Refseq | NP_783594 |
◆ Recombinant Proteins | ||
HIST1H2BA-2095R | Recombinant Rhesus monkey HIST1H2BA Protein, His-tagged | +Inquiry |
HIST1H2BA-427H | Recombinant Human HIST1H2BA Protein, MYC/DDK-tagged | +Inquiry |
HIST1H2BA-3575HF | Recombinant Full Length Human HIST1H2BA Protein, GST-tagged | +Inquiry |
Hist1h2ba-5201M | Recombinant Mouse Hist1h2ba protein | +Inquiry |
Hist1h2ba-5202M | Recombinant Mouse Hist1h2ba protein, Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BA-5543HCL | Recombinant Human HIST1H2BA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hist1h2ba Products
Required fields are marked with *
My Review for All Hist1h2ba Products
Required fields are marked with *