Recombinant Mouse Hmgb1 protein(2-215aa), His-tagged
| Cat.No. : | Hmgb1-5311M |
| Product Overview : | Recombinant Mouse Hmgb1 protein(P63158)(2-215aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-215aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Gene Name | Hmgb1 high mobility group box 1 [ Mus musculus ] |
| Official Symbol | Hmgb1 |
| Synonyms | HMGB1; high mobility group box 1; high mobility group protein B1; high mobility group protein 1; DEF; p30; Hmg1; HMG-1; SBP-1; amphoterin; MGC103168; MGC103169; MGC117896; MGC117897; |
| Gene ID | 15289 |
| mRNA Refseq | NM_010439 |
| Protein Refseq | NP_034569 |
| ◆ Recombinant Proteins | ||
| HMGB1-965H | Recombinant Human HMGB1 Protein, His-tagged | +Inquiry |
| HMGB1-452H | Active Recombinant Human High-Mobility Group Box 1, HIgG1 Fc-tagged | +Inquiry |
| Hmgb1-1625M | Recombinant Mouse Hmgb1 Protein, His-tagged | +Inquiry |
| HMGB1-559H | Active Recombinant Human HMGB1 protein, His-tagged | +Inquiry |
| Hmgb1-37M | Active Recombinant Mouse Hmgb1 Protein (Met1-Asp169), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Native Proteins | ||
| HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
| HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hmgb1 Products
Required fields are marked with *
My Review for All Hmgb1 Products
Required fields are marked with *



