Recombinant Mouse Ifna7 protein
| Cat.No. : | Ifna7-3072M |
| Product Overview : | Recombinant Mouse Ifna7 protein(P06799)(24-190aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 24-190aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.0 kDa |
| AA Sequence : | CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Ifna7 interferon alpha 7 [ Mus musculus ] |
| Official Symbol | Ifna7 |
| Synonyms | IFNA7; interferon alpha 7; interferon alpha-7; IFN-alpha-7; interferon alpha family, gene 7; Ifa7; |
| Gene ID | 15970 |
| mRNA Refseq | NM_008334 |
| Protein Refseq | NP_032360 |
| ◆ Recombinant Proteins | ||
| Ifna7-622M | Recombinant Mouse Ifna7 Protein, His-tagged | +Inquiry |
| IFNA7-621H | Recombinant Human IFNA7 Protein, His-tagged | +Inquiry |
| IFNA7-176H | Active Recombinant Human IFNA7 protein(Cys24-Asp189), hFc-tagged | +Inquiry |
| IFNA7-080H | Recombinant Human IFNA7 Protein | +Inquiry |
| IFNA7-7091H | Recombinant Human IFNA7, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNA7-1703HCL | Recombinant Human IFNA7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifna7 Products
Required fields are marked with *
My Review for All Ifna7 Products
Required fields are marked with *


