Recombinant Mouse Ifnb1 Protein, His-tagged

Cat.No. : Ifnb1-7230M
Product Overview : Recombinant Mouse Interferon beta 1 protein, fused to His-tag, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 22-182
Description : Has antiviral, antibacterial and anticancer activities.
Form : Liquid
Molecular Mass : 22.0 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM HEPES (pH 6.0), 0.5M NaCl, 10 % glycerol
Gene Name Ifnb1 interferon beta 1, fibroblast [ Mus musculus (house mouse) ]
Official Symbol Ifnb1
Synonyms Ifnb1; interferon beta 1, fibroblast; If; Ifb; IFNB; IFN-b; If1da1; IFN-beta; interferon beta; interferon 1da1
Gene ID 15977
mRNA Refseq NM_010510
Protein Refseq NP_034640
UniProt ID P01575

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ifnb1 Products

Required fields are marked with *

My Review for All Ifnb1 Products

Required fields are marked with *

0
cart-icon