Recombinant Mouse Ifnb1 Protein, His-tagged
Cat.No. : | Ifnb1-7230M |
Product Overview : | Recombinant Mouse Interferon beta 1 protein, fused to His-tag, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-182 |
Description : | Has antiviral, antibacterial and anticancer activities. |
Form : | Liquid |
Molecular Mass : | 22.0 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM HEPES (pH 6.0), 0.5M NaCl, 10 % glycerol |
Gene Name | Ifnb1 interferon beta 1, fibroblast [ Mus musculus (house mouse) ] |
Official Symbol | Ifnb1 |
Synonyms | Ifnb1; interferon beta 1, fibroblast; If; Ifb; IFNB; IFN-b; If1da1; IFN-beta; interferon beta; interferon 1da1 |
Gene ID | 15977 |
mRNA Refseq | NM_010510 |
Protein Refseq | NP_034640 |
UniProt ID | P01575 |
◆ Recombinant Proteins | ||
IFNB1-3074H | Recombinant Human IFNB1 protein, GST-tagged | +Inquiry |
Ifnb1-5165R | Recombinant Rat Ifnb1 protein | +Inquiry |
IFNB1-496M | Recombinant Mouse IFNB1 Protein | +Inquiry |
IFNB1-241D | Recombinant Dog IFNB1 Protein, His/GST-tagged | +Inquiry |
Ifnb1-56R | Recombinant Rat Interferon Beta 1, Fibroblast | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifnb1 Products
Required fields are marked with *
My Review for All Ifnb1 Products
Required fields are marked with *