Recombinant Mouse Interferon Beta 1, Fibroblast
Cat.No. : | Ifnb1-37M |
Product Overview : | Recombinant Mouse Interferon beta produced inE.Coliis a single, non-glycosylated polypeptide chain containing 162 amino acids and having a molecular mass of 19.8 kDa. Mouse IFN beta is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Description : | Interferon-beta 1b has antiviral, antibacterial and anticancer activities. Influenza A viruses not only inhibit IFN-beta gene induction but also supress Type-I IFN signaling via mechanism involving induction of the SOCS-3 protein. Intracellular bacteria and cytosolic poly (dA-dT) trigger IFN-beta responses in different human cells without requiring human ZBP1. |
Amino Acid Sequence : | MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQN VFLVFRNNFSS TGWNETIVVRLLDELHQQTVFLKTVLE EKQEERLT WEMSSTAL HLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFR NFLIIRRLTRNFQN. |
Purity : | Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Formulation : | IFN-b Mouse solution containing 10mM sodium phosphate pH-7.5 and 0.5M ammonium sulfate. |
Biological Activity : | Determined in a viral cytopathic effect inhibition assay. |
Stability : | Store the IFN-beta at 4°C for 4 weeks. Do not freeze/thaw. |
Gene Name | Ifnb1 interferon beta 1, fibroblast [ Mus musculus ] |
Synonyms | Ifnb1; interferon beta 1, fibroblast; Ifb; IFNB; IFN-beta; OTTMUSP00000008111; IFB; IFF; IFN-beta; MGC96956; OTTHUMP00000021131; Fibroblast interferon; interferon beta |
Gene ID | 15977 |
mRNA Refseq | NM_010510 |
Protein Refseq | NP_034640 |
UniProt ID | P01575 |
Chromosome Location | 4 42.6 cM |
Pathway | Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Toll-like receptor signaling pathway |
Function | cytokine activity; cytokine receptor binding |
◆ Recombinant Proteins | ||
IFNB1-496M | Recombinant Mouse IFNB1 Protein | +Inquiry |
Ifnb1-544M | Active Recombinant Mouse Ifnb1 | +Inquiry |
IFNB1-93H | Active Recombinant Human Iinterferon, Beta 1, Fibroblast | +Inquiry |
Ifnb1-117M | Recombinant Active Mouse IFNB1 Protein, His-tagged(C-ter) | +Inquiry |
Ifnb1-5169R | Recombinant Rat Ifnb1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifnb1 Products
Required fields are marked with *
My Review for All Ifnb1 Products
Required fields are marked with *