Recombinant Mouse Interferon Beta 1, Fibroblast
| Cat.No. : | Ifnb1-37M |
| Product Overview : | Recombinant Mouse Interferon beta produced inE.Coliis a single, non-glycosylated polypeptide chain containing 162 amino acids and having a molecular mass of 19.8 kDa. Mouse IFN beta is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Description : | Interferon-beta 1b has antiviral, antibacterial and anticancer activities. Influenza A viruses not only inhibit IFN-beta gene induction but also supress Type-I IFN signaling via mechanism involving induction of the SOCS-3 protein. Intracellular bacteria and cytosolic poly (dA-dT) trigger IFN-beta responses in different human cells without requiring human ZBP1. |
| Amino Acid Sequence : | MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQN VFLVFRNNFSS TGWNETIVVRLLDELHQQTVFLKTVLE EKQEERLT WEMSSTAL HLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFR NFLIIRRLTRNFQN. |
| Purity : | Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Formulation : | IFN-b Mouse solution containing 10mM sodium phosphate pH-7.5 and 0.5M ammonium sulfate. |
| Biological Activity : | Determined in a viral cytopathic effect inhibition assay. |
| Stability : | Store the IFN-beta at 4°C for 4 weeks. Do not freeze/thaw. |
| Gene Name | Ifnb1 interferon beta 1, fibroblast [ Mus musculus ] |
| Synonyms | Ifnb1; interferon beta 1, fibroblast; Ifb; IFNB; IFN-beta; OTTMUSP00000008111; IFB; IFF; IFN-beta; MGC96956; OTTHUMP00000021131; Fibroblast interferon; interferon beta |
| Gene ID | 15977 |
| mRNA Refseq | NM_010510 |
| Protein Refseq | NP_034640 |
| UniProt ID | P01575 |
| Chromosome Location | 4 42.6 cM |
| Pathway | Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Toll-like receptor signaling pathway |
| Function | cytokine activity; cytokine receptor binding |
| ◆ Recombinant Proteins | ||
| Ifnb1-41M | Active Recombinant Mouse Ifnb1 Protein (Ile22-Asn182), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| IFNB1-1756H | Active Recombinant Horse IFNB1 protein, His-GST-tagged | +Inquiry |
| Ifnb1-5168R | Recombinant Rat Ifnb1 protein | +Inquiry |
| IFNB1-3102H | Active Recombinant Human IFNB1 protein, His-tagged | +Inquiry |
| IFNB1-2996R | Recombinant Rat IFNB1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
| IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
| IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
| IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifnb1 Products
Required fields are marked with *
My Review for All Ifnb1 Products
Required fields are marked with *
