Recombinant Mouse Irx3 protein

Cat.No. : Irx3-5311M
Product Overview : Recombinant Mouse Irx3 protein(P81067)(462-507 aa) was expressed in Baculovirus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Baculovirus
Tag : Non
Protein Length : 462-507 aa
Form : Tris/PBS-based buffer, 6% Trehalose.
AASequence : EPESGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSSS
Purity : >85% (SDS-PAGE)
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Irx3 Iroquois related homeobox 3 (Drosophila) [ Mus musculus ]
Official Symbol Irx3
Synonyms IRX3; Iroquois related homeobox 3 (Drosophila); iroquois-class homeodomain protein IRX-3; homeodomain protein IRXB1; iroquois homeobox protein 3; AI894186;
Gene ID 16373
mRNA Refseq NM_001253822
Protein Refseq NP_001240751

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Irx3 Products

Required fields are marked with *

My Review for All Irx3 Products

Required fields are marked with *

0
cart-icon
0
compare icon