Recombinant Mouse Itpr3 protein
| Cat.No. : | Itpr3-5106M |
| Product Overview : | Recombinant Mouse Itpr3 protein(P70227)(2517-2670 aa) was expressed in Baculovirus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Baculovirus |
| Tag : | Non |
| Protein Length : | 2517-2670 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | DTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRV KNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVS HLTSQLNELKEQMTEQRKRRQRLGFVDVQNCMSR |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Itpr3 inositol 1,4,5-triphosphate receptor 3 [ Mus musculus ] |
| Official Symbol | Itpr3 |
| Synonyms | ITPR3; inositol 1,4,5-triphosphate receptor 3; inositol 1,4,5-trisphosphate receptor type 3; IP3R 3; insP3R3; IP3 receptor; type 3 InsP3 receptor; type 3 inositol 1,4,5-trisphosphate receptor; Ip3r3; Itpr-3; |
| Gene ID | 16440 |
| mRNA Refseq | NM_080553 |
| Protein Refseq | NP_542120 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Itpr3 Products
Required fields are marked with *
My Review for All Itpr3 Products
Required fields are marked with *



