Recombinant Mouse Kcnj10 Full Length Transmembrane protein, His-tagged
Cat.No. : | Kcnj10-294M |
Product Overview : | Recombinant Mouse Kcnj10 protein(Q9JM63)(1-379aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-379aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Kcnj10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Mus musculus ] |
Official Symbol | Kcnj10 |
Synonyms | KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; inward rectifier K(+) channel Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; BIR10; BIRK-1; Kir1.2; Kir4.1; |
Gene ID | 16513 |
mRNA Refseq | NM_001039484 |
Protein Refseq | NP_001034573 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kcnj10 Products
Required fields are marked with *
My Review for All Kcnj10 Products
Required fields are marked with *