Recombinant Mouse Klk1b22 Protein, His-tagged

Cat.No. : Klk1b22-339M
Product Overview : Recombinant Mouse Klk1b22 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 259
Description : This gene encodes the beta subunit of the 7S nerve growth factor (NGF) complex that is essential for the differentiation and survival of distinct populations of neurons in both the central and the peripheral nervous systems. The encoded preproprotein undergoes proteolytic processing to generate a functional, mature peptide. This gene is located in a cluster of several related kallikrein genes on chromosome 7.
Form : Lyophilized
Molecular Mass : 27.3 kDa
AA Sequence : MRFLILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Publications :
Serendipitous Discovery of T Cell–Produced KLK1b22 as a Regulator of Systemic Metabolism (2023)
Gene Name Klk1b22 kallikrein 1-related peptidase b22 [ Mus musculus (house mouse) ]
Official Symbol Klk1b22
Synonyms Klk1b22; kallikrein 1-related peptidase b22; Klk22; Egfbp1; mGk-22; Egfbp-1; EGF-BP A; kallikrein 1-related peptidase b22; beta-NGF-endopeptidase; epidermal growth factor-binding protein type A; glandular kallikrein K22; nerve growth factor beta chain endopeptidase; tissue kallikrein 22; EC 3.4.21.35
Gene ID 13646
mRNA Refseq NM_010114
Protein Refseq NP_034244
UniProt ID P15948

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Klk1b22 Products

Required fields are marked with *

My Review for All Klk1b22 Products

Required fields are marked with *

0
cart-icon
0
compare icon