| Species : |
Mouse |
| Source : |
HEK293 |
| Tag : |
His |
| Description : |
Involved in neurotransmitter receptor localization to postsynaptic specialization membrane. Located in extracellular space and glutamatergic synapse. Is active in synaptic cleft. Is expressed in several structures, including central nervous system; diaphragm; sensory organ; and skeletal musculature. Used to study familial temporal lobe epilepsy 1. Human ortholog(s) of this gene implicated in familial temporal lobe epilepsy 1. Orthologous to human LGI1 (leucine rich glioma inactivated 1). |
| Molecular Mass : |
The protein has a calculated MW of 61 kDa. |
| AA Sequence : |
KKPAKPKCPAVCTCSKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNAFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSPKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIDTQLYVIVAQLFGGSHIYKRDGFANKFIKIQDIEVLKIRKPNDIETFKIEDNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIARPPLALRTPHLILSSSSQRPVIYQWSKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSAHHHHHHHH |
| Purity : |
> 90% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.19 mg/mL by BCA |
| Storage Buffer : |
Sterile PBS, pH 7.4, 1% SKL, 10% Glycerol |
| Publications : |
|