Recombinant Mouse LGI1 Protein, His tagged
Cat.No. : | LGI1-9069ME |
Product Overview : | Recombinant Mouse LGI1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Involved in neurotransmitter receptor localization to postsynaptic specialization membrane. Located in extracellular space and glutamatergic synapse. Is active in synaptic cleft. Is expressed in several structures, including central nervous system; diaphragm; sensory organ; and skeletal musculature. Used to study familial temporal lobe epilepsy 1. Human ortholog(s) of this gene implicated in familial temporal lobe epilepsy 1. Orthologous to human LGI1 (leucine rich glioma inactivated 1). |
Molecular Mass : | The protein has a calculated MW of 61 kDa. |
AA Sequence : | MKKPAKPKCPAVCTCSKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNAFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSPKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIDTQLYVIVAQLFGGSHIYKRDGFANKFIKIQDIEVLKIRKPNDIETFKIEDNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIARPPLALRTPHLILSSSSQRPVIYQWSKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSAHHHHHHHH |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.11 mg/mL by BCA |
Storage Buffer : | Sterile 50 mM Tris, 200 mM NaCl, 0.05% SKL, pH8.5 |
Gene Name | Lgi1 leucine-rich repeat LGI family, member 1 [ Mus musculus (house mouse) ] |
Official Symbol | Lgi1 |
Synonyms | LGI1; leucine-rich repeat LGI family, member 1; leucine-rich glioma-inactivated protein 1; leucine-rich, glioma inactivated 1; BB130740; |
Gene ID | 56839 |
mRNA Refseq | NM_020278 |
Protein Refseq | NP_064674 |
UniProt ID | Q9JIA1 |
◆ Recombinant Proteins | ||
LGI1-9069M | Recombinant Mouse LGI1 Protein, His tagged | +Inquiry |
LGI1-4353H | Recombinant Human LGI1 protein, His&Myc-tagged | +Inquiry |
LGI1-3393R | Recombinant Rat LGI1 Protein | +Inquiry |
LGI1-2503R | Recombinant Rhesus monkey LGI1 Protein, His-tagged | +Inquiry |
LGI1-9069ME | Recombinant Mouse LGI1 Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
LGI1-02HFL | Recombinant Full Length Human LGI1 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGI1-4759HCL | Recombinant Human LGI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGI1 Products
Required fields are marked with *
My Review for All LGI1 Products
Required fields are marked with *
0
Inquiry Basket