Recombinant Mouse Lgi3 protein, His&Myc-tagged
Cat.No. : | Lgi3-2330M |
Product Overview : | Recombinant Mouse Lgi3 protein(Q8K406)(31-548aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 31-548aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 62.5 kDa |
AA Sequence : | KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lgi3 leucine-rich repeat LGI family, member 3 [ Mus musculus ] |
Official Symbol | Lgi3 |
Synonyms | LGI3; leucine-rich repeat LGI family, member 3; leucine-rich repeat LGI family member 3; leubrin; leucine-rich glioma-inactivated protein 3; AI841179; AW049851; |
Gene ID | 213469 |
mRNA Refseq | NM_145219 |
Protein Refseq | NP_660254 |
◆ Recombinant Proteins | ||
LGI3-7575H | Recombinant Human LGI3 protein, His-tagged | +Inquiry |
LGI3-3646Z | Recombinant Zebrafish LGI3 | +Inquiry |
LGI3-1751H | Recombinant Human LGI3 protein, His & T7-tagged | +Inquiry |
LGI3-555H | Recombinant Human LGI3, His-tagged | +Inquiry |
LGI3-4080H | Recombinant Human LGI3 Protein (Lys261-Ala548), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgi3 Products
Required fields are marked with *
My Review for All Lgi3 Products
Required fields are marked with *
0
Inquiry Basket