Recombinant Mouse Lgi3 protein, His&Myc-tagged
| Cat.No. : | Lgi3-2330M |
| Product Overview : | Recombinant Mouse Lgi3 protein(Q8K406)(31-548aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 31-548aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 62.5 kDa |
| AA Sequence : | KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Lgi3 leucine-rich repeat LGI family, member 3 [ Mus musculus ] |
| Official Symbol | Lgi3 |
| Synonyms | LGI3; leucine-rich repeat LGI family, member 3; leucine-rich repeat LGI family member 3; leubrin; leucine-rich glioma-inactivated protein 3; AI841179; AW049851; |
| Gene ID | 213469 |
| mRNA Refseq | NM_145219 |
| Protein Refseq | NP_660254 |
| ◆ Recombinant Proteins | ||
| Lgi3-4623M | Recombinant Mouse Lgi3 protein, His-tagged | +Inquiry |
| LGI3-2504R | Recombinant Rhesus monkey LGI3 Protein, His-tagged | +Inquiry |
| LGI3-2325R | Recombinant Rhesus Macaque LGI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LGI3-555H | Recombinant Human LGI3, His-tagged | +Inquiry |
| LGI3-1751H | Recombinant Human LGI3 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgi3 Products
Required fields are marked with *
My Review for All Lgi3 Products
Required fields are marked with *




