Recombinant Mouse Lgmn protein, His-tagged
Cat.No. : | Lgmn-3172M |
Product Overview : | Recombinant Mouse Lgmn protein(O89017)(18-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-325aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Lgmn legumain [ Mus musculus ] |
Official Symbol | Lgmn |
Synonyms | LGMN; legumain; preprolegumain; protease, cysteine 1; protease, cysteine, 1; asparaginyl endopeptidase; AEP; Prsc1; AI746452; AU022324; |
Gene ID | 19141 |
mRNA Refseq | NM_011175 |
Protein Refseq | NP_035305 |
◆ Recombinant Proteins | ||
Lgmn-5062M | Recombinant Mouse Lgmn Protein, His (Fc)-Avi-tagged | +Inquiry |
LGMN-3669H | Recombinant Human LGMN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGMN-5017H | Recombinant Human LGMN Protein (Pro19-His432), N-His tagged | +Inquiry |
LGMN-2549C | Recombinant Cynomolgus Monkey LGMN Protein (18-323 aa), His-Myc-tagged | +Inquiry |
LGMN-216H | Recombinant Human LGMN protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
LGMN-001SCL | Recombinant Sus scrofa (Pig) LGMN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgmn Products
Required fields are marked with *
My Review for All Lgmn Products
Required fields are marked with *