Recombinant Mouse Lgmn protein, His-tagged
| Cat.No. : | Lgmn-3172M |
| Product Overview : | Recombinant Mouse Lgmn protein(O89017)(18-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 18-325aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.8 kDa |
| AA Sequence : | VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Lgmn legumain [ Mus musculus ] |
| Official Symbol | Lgmn |
| Synonyms | LGMN; legumain; preprolegumain; protease, cysteine 1; protease, cysteine, 1; asparaginyl endopeptidase; AEP; Prsc1; AI746452; AU022324; |
| Gene ID | 19141 |
| mRNA Refseq | NM_011175 |
| Protein Refseq | NP_035305 |
| ◆ Recombinant Proteins | ||
| LGMN-2623H | Recombinant Human LGMN Protein (Ile18-Tyr433), His tagged | +Inquiry |
| Lgmn-303M | Recombinant Mouse Lgmn protein(Val18-Tyr435), His-tagged | +Inquiry |
| LGMN-570P | Recombinant Pig LGMN, His-tagged | +Inquiry |
| LGMN-31M | Recombinant Mouse LGMN Protein, His-tagged | +Inquiry |
| LGMN-3050R | Recombinant Rat LGMN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGMN-225HKCL | Human LGMN Knockdown Cell Lysate | +Inquiry |
| LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
| LGMN-001SCL | Recombinant Sus scrofa (Pig) LGMN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgmn Products
Required fields are marked with *
My Review for All Lgmn Products
Required fields are marked with *



