Recombinant Mouse Lilrb4 Protein, Fc-tagged
| Cat.No. : | Lilrb4-361M |
| Product Overview : | Recombinant Mouse Lilrb4 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 335 |
| Description : | Enables integrin binding activity. Involved in negative regulation of mast cell activation involved in immune response. Acts upstream of or within several processes, including alpha-beta T cell proliferation; cellular response to lipopolysaccharide; and response to nematode. Located in external side of plasma membrane. Is expressed in urinary system. Orthologous to human LILRB4 (leukocyte immunoglobulin like receptor B4). |
| Form : | Lyophilized |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKILIGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVYAQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | Lilrb4 leukocyte immunoglobulin-like receptor, subfamily B, member 4 [ Mus musculus (house mouse) ] |
| Official Symbol | Lilrb4 |
| Synonyms | HM18; ILT3; gp49; CD85K; Gp49b; LIR-5 |
| Gene ID | 14728 |
| mRNA Refseq | NM_013532 |
| Protein Refseq | NP_038560 |
| UniProt ID | Q64281 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lilrb4 Products
Required fields are marked with *
My Review for All Lilrb4 Products
Required fields are marked with *



