Recombinant Mouse Lrpap1 protein, GFP-tagged
Cat.No. : | Lrpap1-5743M |
Product Overview : | Recombinant Mouse Lrpap1 protein(P55302)(248-360aa), fused with N-terminal GFP tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | GFP |
Protein Length : | 248-360aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL |
Gene Name | Lrpap1 low density lipoprotein receptor-related protein associated protein 1 [ Mus musculus ] |
Official Symbol | Lrpap1 |
Synonyms | LRPAP1; low density lipoprotein receptor-related protein associated protein 1; alpha-2-macroglobulin receptor-associated protein; HBP-44; alpha-2-MRAP; heparin-binding protein 44; low density lipoprotein receptor-related protein-associated protein 1; low density lipoprotein receptor related protein, associated protein 1; Alpha-2-macroglobulin receptor-associated protein precursor (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) (Heparin binding protein-44) (HBP-44); RAP; HBP44; C77774; AA617339; AI790446; AU042172; |
Gene ID | 16976 |
mRNA Refseq | NM_013587 |
Protein Refseq | NP_038615 |
◆ Recombinant Proteins | ||
LRPAP1-4460H | Recombinant Human LRPAP1 Protein (Tyr35-Leu357), N-His tagged | +Inquiry |
LRPAP1-6619C | Recombinant Chicken LRPAP1 | +Inquiry |
Lrpap1-5744M | Recombinant Mouse Lrpap1 protein, GFP-tagged | +Inquiry |
LRPAP1-4687H | Recombinant Human LRPAP1 Protein, GST-tagged | +Inquiry |
Lrpap1-5913M | Recombinant Mouse Lrpap1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRPAP1-2168MCL | Recombinant Mouse LRPAP1 cell lysate | +Inquiry |
LRPAP1-2574HCL | Recombinant Human LRPAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lrpap1 Products
Required fields are marked with *
My Review for All Lrpap1 Products
Required fields are marked with *