Recombinant Mouse Lrpap1 protein, GFP-tagged
| Cat.No. : | Lrpap1-5743M |
| Product Overview : | Recombinant Mouse Lrpap1 protein(P55302)(248-360aa), fused with N-terminal GFP tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | GFP |
| Protein Length : | 248-360aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL |
| Gene Name | Lrpap1 low density lipoprotein receptor-related protein associated protein 1 [ Mus musculus ] |
| Official Symbol | Lrpap1 |
| Synonyms | LRPAP1; low density lipoprotein receptor-related protein associated protein 1; alpha-2-macroglobulin receptor-associated protein; HBP-44; alpha-2-MRAP; heparin-binding protein 44; low density lipoprotein receptor-related protein-associated protein 1; low density lipoprotein receptor related protein, associated protein 1; Alpha-2-macroglobulin receptor-associated protein precursor (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) (Heparin binding protein-44) (HBP-44); RAP; HBP44; C77774; AA617339; AI790446; AU042172; |
| Gene ID | 16976 |
| mRNA Refseq | NM_013587 |
| Protein Refseq | NP_038615 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lrpap1 Products
Required fields are marked with *
My Review for All Lrpap1 Products
Required fields are marked with *
