Recombinant Mouse Lrpap1 protein, GFP-tagged

Cat.No. : Lrpap1-5744M
Product Overview : Recombinant Mouse Lrpap1 protein(P55302)(248-360aa(H294F,H296F,Y297C,H305F)), fused with N-terminal GFP tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : GFP
Protein Length : 248-360aa(H294F,H296F,Y297C,H305F)
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.6 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Gene Name Lrpap1 low density lipoprotein receptor-related protein associated protein 1 [ Mus musculus ]
Official Symbol Lrpap1
Synonyms LRPAP1; low density lipoprotein receptor-related protein associated protein 1; alpha-2-macroglobulin receptor-associated protein; HBP-44; alpha-2-MRAP; heparin-binding protein 44; low density lipoprotein receptor-related protein-associated protein 1; low density lipoprotein receptor related protein, associated protein 1; Alpha-2-macroglobulin receptor-associated protein precursor (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) (Heparin binding protein-44) (HBP-44); RAP; HBP44; C77774; AA617339; AI790446; AU042172;
Gene ID 16976
mRNA Refseq NM_013587
Protein Refseq NP_038615

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lrpap1 Products

Required fields are marked with *

My Review for All Lrpap1 Products

Required fields are marked with *

0
cart-icon