Recombinant Mouse LY6E Protein (21-102 aa), His-SUMO-tagged

Cat.No. : LY6E-1743M
Product Overview : Recombinant Mouse LY6E Protein (21-102 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His&SUMO
Protein Length : 21-102 aa
Description : Involved in T-cell development.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.8 kDa
AA Sequence : LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ]
Official Symbol LY6E
Synonyms LY6E; ly-6E; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1;
Gene ID 17069
mRNA Refseq NM_001164036
Protein Refseq NP_001157508
UniProt ID Q64253

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6E Products

Required fields are marked with *

My Review for All LY6E Products

Required fields are marked with *

0
cart-icon
0
compare icon