Recombinant Mouse LY6E Protein (21-102 aa), His-SUMO-tagged
| Cat.No. : | LY6E-1743M |
| Product Overview : | Recombinant Mouse LY6E Protein (21-102 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His&SUMO |
| Protein Length : | 21-102 aa |
| Description : | Involved in T-cell development. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.8 kDa |
| AA Sequence : | LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ] |
| Official Symbol | LY6E |
| Synonyms | LY6E; ly-6E; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1; |
| Gene ID | 17069 |
| mRNA Refseq | NM_001164036 |
| Protein Refseq | NP_001157508 |
| UniProt ID | Q64253 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6E Products
Required fields are marked with *
My Review for All LY6E Products
Required fields are marked with *
