Recombinant Mouse Mbl2 protein(19-244aa), His-tagged
Cat.No. : | Mbl2-4928M |
Product Overview : | Recombinant Mouse Mbl2 protein(Q3UEK1)(19-244aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-244aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD |
Gene Name | Mbl2 mannose-binding lectin (protein C) 2 [ Mus musculus ] |
Official Symbol | Mbl2 |
Synonyms | MBL2; mannose-binding lectin (protein C) 2; mannose-binding protein C; RARF/P28A; mannan-binding protein; mannose binding lectin (C); RA-reactive factor P28A subunit; mannose binding lectin, liver (C); MBL; L-MBP; MBL-C; MBP-C; |
Gene ID | 17195 |
mRNA Refseq | NM_010776 |
Protein Refseq | NP_034906 |
◆ Recombinant Proteins | ||
Mbl2-7021R | Recombinant Rat Mbl2 protein, His-tagged | +Inquiry |
MBL2-4449H | Recombinant Human MBL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mbl2-3980M | Recombinant Mouse Mbl2 Protein, Myc/DDK-tagged | +Inquiry |
Mbl2-7022R | Recombinant Rat Mbl2 protein, His & GST-tagged | +Inquiry |
MBL2-575H | Recombinant Human MBL2 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBL2-001HCL | Recombinant Human MBL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mbl2 Products
Required fields are marked with *
My Review for All Mbl2 Products
Required fields are marked with *