Recombinant Mouse MCPT4 Protein (21-246 aa), His-tagged

• Cat.No.: MCPT4-2050M
• Product Overview: Recombinant Mouse MCPT4 Protein (21-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 21-246 aa
• Description: Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.1 kDa
• AA Sequence: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Mcpt4 mast cell protease 4 [ Mus musculus ]
• Official Symbol: MCPT4
• Synonyms: MCPT4; MSMCP; myonase; Mcp4; Mcp-4; MMCP-4; MMCP-4A; MMCP-4B
• Gene ID: 17227
• mRNA Refseq: NM_010779
• Protein Refseq: NP_034909
• UniProt ID: P21812