Recombinant Mouse Mesd Protein, His-tagged
| Cat.No. : | Mesd-7410M |
| Product Overview : | Recombinant Mouse Mesd protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 30-224 |
| Description : | Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction. Plays an essential role in neuromuscular junction (NMJ) formation by promoting cell-surface expression of LRP4. May regulate phagocytosis of apoptotic retinal pigment epithelium (RPE) cells. |
| Form : | Liquid |
| Molecular Mass : | 24.4 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSADTPGEATPPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRRE? |
| Purity : | > 90 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
| Gene Name | Mesd mesoderm development LRP chaperone [ Mus musculus (house mouse) ] |
| Official Symbol | Mesd |
| Synonyms | Mesd; mesoderm development LRP chaperone; ms; msd; mesd; Mesdc; Mesdc2; AW537813; mKIAA0081; 2210015O11Rik; LRP chaperone MESD; LDLR chaperone MESD; mesoderm development candidate 2 |
| Gene ID | 67943 |
| mRNA Refseq | NM_023403 |
| Protein Refseq | NP_075892 |
| UniProt ID | Q9ERE7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mesd Products
Required fields are marked with *
My Review for All Mesd Products
Required fields are marked with *



