Recombinant Mouse Mesd Protein, His-tagged

Cat.No. : Mesd-7410M
Product Overview : Recombinant Mouse Mesd protein with a His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 30-224
Description : Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction. Plays an essential role in neuromuscular junction (NMJ) formation by promoting cell-surface expression of LRP4. May regulate phagocytosis of apoptotic retinal pigment epithelium (RPE) cells.
Form : Liquid
Molecular Mass : 24.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSADTPGEATPPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRRE?
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Mesd mesoderm development LRP chaperone [ Mus musculus (house mouse) ]
Official Symbol Mesd
Synonyms Mesd; mesoderm development LRP chaperone; ms; msd; mesd; Mesdc; Mesdc2; AW537813; mKIAA0081; 2210015O11Rik; LRP chaperone MESD; LDLR chaperone MESD; mesoderm development candidate 2
Gene ID 67943
mRNA Refseq NM_023403
Protein Refseq NP_075892
UniProt ID Q9ERE7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mesd Products

Required fields are marked with *

My Review for All Mesd Products

Required fields are marked with *

0
cart-icon