Recombinant Mouse MUP11 Protein (1-151 aa), His-tagged

• Cat.No.: MUP11-1620M
• Product Overview: Recombinant Mouse MUP11 Protein (1-151 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 1-151 aa
• Description: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.6 kDa
• AA Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Mup11 major urinary protein 11 [ Mus musculus (house mouse) ]
• Official Symbol: MUP11
• Synonyms: Mup16; Mup18; Gm12549
• Gene ID: 100039028
• mRNA Refseq: NM_001164526
• Protein Refseq: NP_001157998
• UniProt ID: P04938