Recombinant Mouse MUP11 Protein (1-151 aa), His-tagged
Cat.No. : | MUP11-1620M |
Product Overview : | Recombinant Mouse MUP11 Protein (1-151 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-151 aa |
Description : | Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.6 kDa |
AA Sequence : | REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Mup11 major urinary protein 11 [ Mus musculus (house mouse) ] |
Official Symbol | MUP11 |
Synonyms | Mup16; Mup18; Gm12549; |
Gene ID | 100039028 |
mRNA Refseq | NM_001164526 |
Protein Refseq | NP_001157998 |
UniProt ID | P04938 |
◆ Recombinant Proteins | ||
Mup11-4197M | Recombinant Mouse Mup11 protein, His-tagged | +Inquiry |
MUP11-5809M | Recombinant Mouse MUP11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MUP11-1620M | Recombinant Mouse MUP11 Protein (1-151 aa), His-tagged | +Inquiry |
MUP11-10242M | Recombinant Mouse MUP11 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MUP11 Products
Required fields are marked with *
My Review for All MUP11 Products
Required fields are marked with *
0
Inquiry Basket