Recombinant Mouse Myc, Arg-tagged
| Cat.No. : | Myc-71M |
| Product Overview : | Recombinant Mouse c-Myc-polyR is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ala439) of Mouse c-Myc fused with a poly-Arginine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 1-439 a.a. |
| AA Sequence : | MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSR RSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNII IQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVV FPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEE EIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRA KLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKA PKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | Myc myelocytomatosis oncogene [ Mus musculus ] |
| Official Symbol | Myc |
| Synonyms | MYC; myelocytomatosis oncogene; myc proto-oncogene protein; c-myc proto-oncogene; transcription factor p64; Myc2; Nird; Niard; bHLHe39; AU016757; |
| Gene ID | 17869 |
| mRNA Refseq | NM_001177352 |
| Protein Refseq | NP_001170823 |
| Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
| Function | DNA binding; DNA binding; E-box binding; double-stranded DNA binding; protein binding; protein complex binding; protein heterodimerization activity; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; |
| ◆ Recombinant Proteins | ||
| MYC-2916R | Recombinant Rhesus monkey MYC Protein, His-tagged | +Inquiry |
| MYC-38H | Recombinant Human MYC, His-tagged | +Inquiry |
| MYC-4637H | Recombinant Human MYC Protein (351-437), His tagged | +Inquiry |
| MYC-5787H | Recombinant Human MYC Protein, GST-tagged | +Inquiry |
| MYC-1028H | Active Recombinant Human MYC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Myc Products
Required fields are marked with *
My Review for All Myc Products
Required fields are marked with *



