Recombinant Mouse Ninj1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Ninj1-2849M |
| Product Overview : | Recombinant Mouse Ninj1 protein(O70131)(1-152aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-152aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.1 kDa |
| AA Sequence : | MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Ninj1 ninjurin 1 [ Mus musculus ] |
| Official Symbol | Ninj1 |
| Synonyms | NINJ1; ninjurin 1; ninjurin-1; nerve injury-induced protein 1; AU024536; |
| Gene ID | 18081 |
| mRNA Refseq | NM_013610 |
| Protein Refseq | NP_038638 |
| ◆ Recombinant Proteins | ||
| NINJ1-12H | Recombinant Human NINJ1 Protein (1-152), N-GST tagged | +Inquiry |
| NINJ1-10H | Recombinant Human NINJ1 Protein, Met1~Leu80, N-His tagged | +Inquiry |
| RFL12896HF | Recombinant Full Length Human Ninjurin-1(Ninj1) Protein, His-Tagged | +Inquiry |
| NINJ1-3030R | Recombinant Rhesus monkey NINJ1 Protein, His-tagged | +Inquiry |
| NINJ1-1112R | Recombinant Rat NINJ1 Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NINJ1-1546RCL | Recombinant Rat NINJ1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ninj1 Products
Required fields are marked with *
My Review for All Ninj1 Products
Required fields are marked with *



