Recombinant Mouse Ninj1 Full Length Transmembrane protein, His-tagged
Cat.No. : | Ninj1-2849M |
Product Overview : | Recombinant Mouse Ninj1 protein(O70131)(1-152aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-152aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.1 kDa |
AA Sequence : | MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Ninj1 ninjurin 1 [ Mus musculus ] |
Official Symbol | Ninj1 |
Synonyms | NINJ1; ninjurin 1; ninjurin-1; nerve injury-induced protein 1; AU024536; |
Gene ID | 18081 |
mRNA Refseq | NM_013610 |
Protein Refseq | NP_038638 |
◆ Recombinant Proteins | ||
NINJ1-10666M | Recombinant Mouse NINJ1 Protein | +Inquiry |
NINJ1-13H | Recombinant Human NINJ1 Protein (Asp2-Val81), C-6×His tagged | +Inquiry |
NINJ1-3647R | Recombinant Rat NINJ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ninj1-177M | Recombinant Mouse ninjurin 1 Protein, His&Flag tagged | +Inquiry |
RFL12896HF | Recombinant Full Length Human Ninjurin-1(Ninj1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NINJ1-1546RCL | Recombinant Rat NINJ1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ninj1 Products
Required fields are marked with *
My Review for All Ninj1 Products
Required fields are marked with *
0
Inquiry Basket