Recombinant Mouse Nphs1 protein, His-tagged
Cat.No. : | Nphs1-4595M |
Product Overview : | Recombinant Mouse Nphs1 protein(Q9QZS7)(36-250 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 36-250 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 29.6 kDa |
AASequence : | AQSPVPTSAPRGFWALSENLTVVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVILSILVSPKVLQLTPEAGSTVTWVAGQEYVVTCVSGDAKPAPDIIFIQGGRTVEDVSSSVNEGSEEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATPIKASFTMNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Nphs1 nephrosis 1 homolog, nephrin (human) [ Mus musculus ] |
Official Symbol | Nphs1 |
Synonyms | NPHS1; nephrosis 1 homolog, nephrin (human); nephrin; nephrin 1; renal glomerulus-specific cell adhesion receptor; NephrinB; |
Gene ID | 54631 |
mRNA Refseq | NM_019459 |
Protein Refseq | NP_062332 |
◆ Recombinant Proteins | ||
NPHS1-689H | Recombinant Human NPHS1 Protein (23-257 aa), His-tagged | +Inquiry |
NPHS1-2475H | Recombinant Human NPHS1 protein(441-630 aa), N-SUMO & C-His-tagged | +Inquiry |
Nphs1-6162M | Recombinant Mouse Nphs1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nphs1-5642R | Recombinant Rat Nphs1 protein, His & GST-tagged | +Inquiry |
NPHS1-29301TH | Recombinant Human NPHS1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nphs1 Products
Required fields are marked with *
My Review for All Nphs1 Products
Required fields are marked with *