Recombinant Mouse Nphs1 protein, His-tagged
| Cat.No. : | Nphs1-4595M |
| Product Overview : | Recombinant Mouse Nphs1 protein(Q9QZS7)(36-250 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 36-250 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 29.6 kDa |
| AASequence : | AQSPVPTSAPRGFWALSENLTVVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVILSILVSPKVLQLTPEAGSTVTWVAGQEYVVTCVSGDAKPAPDIIFIQGGRTVEDVSSSVNEGSEEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATPIKASFTMNI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Nphs1 nephrosis 1 homolog, nephrin (human) [ Mus musculus ] |
| Official Symbol | Nphs1 |
| Synonyms | NPHS1; nephrosis 1 homolog, nephrin (human); nephrin; nephrin 1; renal glomerulus-specific cell adhesion receptor; NephrinB; |
| Gene ID | 54631 |
| mRNA Refseq | NM_019459 |
| Protein Refseq | NP_062332 |
| ◆ Recombinant Proteins | ||
| NPHS1-3815Z | Recombinant Zebrafish NPHS1 | +Inquiry |
| NPHS1-3581H | Recombinant Human NPHS1 protein, His-tagged | +Inquiry |
| NPHS1-10822M | Recombinant Mouse NPHS1 Protein | +Inquiry |
| Nphs1-718M | Active Recombinant Mouse Nphs1 Protein, His-tagged | +Inquiry |
| Nphs1-1343M | Recombinant Mouse Nphs1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nphs1 Products
Required fields are marked with *
My Review for All Nphs1 Products
Required fields are marked with *
