Recombinant Mouse Nphs1 protein, His-tagged

• Cat.No.: Nphs1-4595M
• Product Overview: Recombinant Mouse Nphs1 protein(Q9QZS7)(36-250 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 36-250 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 29.6 kDa
• AASequence: AQSPVPTSAPRGFWALSENLTVVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVILSILVSPKVLQLTPEAGSTVTWVAGQEYVVTCVSGDAKPAPDIIFIQGGRTVEDVSSSVNEGSEEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATPIKASFTMNI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Nphs1 nephrosis 1 homolog, nephrin (human) [ Mus musculus ]
• Official Symbol: Nphs1
• Synonyms: NPHS1; nephrosis 1 homolog, nephrin (human); nephrin; nephrin 1; renal glomerulus-specific cell adhesion receptor; NephrinB
• Gene ID: 54631
• mRNA Refseq: NM_019459
• Protein Refseq: NP_062332