Recombinant Mouse Nptx1 protein, hFc-tagged
| Cat.No. : | Nptx1-6733M |
| Product Overview : | Recombinant Mouse Nptx1 protein(Q62443)(23-432aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 23-432aa |
| Tag : | C-hFc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 73.9 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQLRETVLQQKETILSQKETIRELTTKLGRCESQSTLDSGPGEARSGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNTLEEGKGGPKNDTEERAKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSSKALSGNVIAWAESQIEIFGGATKWTFEACRQIN |
| Gene Name | Nptx1 neuronal pentraxin 1 [ Mus musculus ] |
| Official Symbol | Nptx1 |
| Synonyms | NPTX1; neuronal pentraxin 1; neuronal pentraxin-1; NP-I; neuronal pentraxin I; Np1; D11Bwg1004e; |
| Gene ID | 18164 |
| mRNA Refseq | NM_008730 |
| Protein Refseq | NP_032756 |
| ◆ Recombinant Proteins | ||
| Nptx1-6733M | Recombinant Mouse Nptx1 protein, hFc-tagged | +Inquiry |
| Nptx1-398M | Recombinant Mouse Nptx1 Protein, His/GST-tagged | +Inquiry |
| NPTX1-2903R | Recombinant Rhesus Macaque NPTX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NPTX1-3533H | Recombinant Human NPTX1 protein, His-GST&Myc-tagged | +Inquiry |
| NPTX1-397H | Recombinant Human NPTX1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nptx1 Products
Required fields are marked with *
My Review for All Nptx1 Products
Required fields are marked with *
