Recombinant Mouse Ocm protein, His-SUMO-tagged
Cat.No. : | Ocm-3299M |
Product Overview : | Recombinant Mouse Ocm protein(P51879)(2-109aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-109aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.1 kDa |
AA Sequence : | SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ocm oncomodulin [ Mus musculus ] |
Official Symbol | Ocm |
Synonyms | OCM; oncomodulin; OM; parvalbumin beta; |
Gene ID | 18261 |
mRNA Refseq | NM_033039 |
Protein Refseq | NP_149028 |
◆ Recombinant Proteins | ||
OCM-6309M | Recombinant Mouse OCM Protein, His (Fc)-Avi-tagged | +Inquiry |
OCM-5992C | Recombinant Chicken OCM | +Inquiry |
OCM-11067M | Recombinant Mouse OCM Protein | +Inquiry |
Ocm-773R | Recombinant Rat Ocm Protein, His-tagged | +Inquiry |
OCM-1441H | Recombinant Human OCM, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCM-453HCL | Recombinant Human OCM lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ocm Products
Required fields are marked with *
My Review for All Ocm Products
Required fields are marked with *