"Pdgfd" Related Products

Expand
Expand
Expand

Recombinant Mouse Pdgfd protein, His/SUMO-tagged

Cat.No.: Pdgfd-390M
Product Overview: Recombinant Mouse Pdgfd(24-370aa) fused with His/SUMO tag was expressed in E. coli.
Source: E. coli
Species: Mouse
Tag: His/SUMO
Form: 20mM Tris-HCl based buffer,pH8.0
Molecular Mass: 56.2kD
Protein length: 24-370aa
AA Sequence: TPQRASIKALRNANLRRDESNHLTDLYQREENIQVTSNGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQLSFDHQ FGLEEAENDICRYDFVEVEEVSESSTVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDF QPEAASETNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLYLDTPHYRG RSYHDRKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTVNWKSCTCSSGKT VKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPR
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name: Pdgfd platelet-derived growth factor, D polypeptide [ Mus musculus ]
Official Symbol: Pdgfd
Synonyms: PDGFD; platelet-derived growth factor, D polypeptide; platelet-derived growth factor D; PDGF-D; SCDGF-B; spinal cord-derived growth factor B; 1110003I09Rik;
Gene ID: 71785
mRNA Refseq: NM_027924
Protein Refseq: NP_082200
MIM:
UniProt ID: Q925I7
Chromosome Location: 9; 9 A1
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Gap junction, organism-specific biosystem; Gap junction, conserved biosystem;
Function: growth factor activity; platelet-derived growth factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.