Recombinant Mouse Pkdcc protein, His&Myc-tagged

• Cat.No.: Pkdcc-2319M
• Product Overview: Recombinant Mouse Pkdcc protein(Q5RJI4)(33-492aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 33-492aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.4 kDa
• AA Sequence: PRPGQSPGSSAAPGPGRRGGRGELARQIRERYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLQRPRPPRVRSPPDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYVGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGARRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEGIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVNGELKVTDLDDARVEETPCTSSADCTLEFPARNFSLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLETALHLFRSGQYLQNSTSSRAEYQRIPDSAITQEDYRCWPSYHHGGCLLSVFNLAEAIDVCESHAQCRAFVVTNQTTWTGRKLVFFKTGWNQVVPDAGKTTYVKAPG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Pkdcc protein kinase domain containing, cytoplasmic [ Mus musculus ]
• Official Symbol: Pkdcc
• Synonyms: PKDCC; protein kinase domain containing, cytoplasmic; protein kinase domain-containing protein, cytoplasmic; sugen kinase 493; vertebrate lonesome kinase; protein kinase-like protein SgK493; Vlk; MAd1; Adtk1; ESTM17; Sgk493; X83346; AI115348; AW548124; MGC99930
• Gene ID: 106522
• mRNA Refseq: NM_134117
• Protein Refseq: NP_598878