Recombinant Mouse Pla2g12a protein, His&Myc-tagged
| Cat.No. : | Pla2g12a-2338M |
| Product Overview : | Recombinant Mouse Pla2g12a protein(Q9EPR2)(26-192aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 26-192aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.6 kDa |
| AA Sequence : | QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Pla2g12a phospholipase A2, group XIIA [ Mus musculus ] |
| Official Symbol | Pla2g12a |
| Synonyms | PLA2G12A; phospholipase A2, group XIIA; group XIIA secretory phospholipase A2; sPLA2-XII; GXII sPLA2; group XII-1 phospholipase A2; group XIIA secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 12A; GXII; Rossy; Pla2g12; mGXII-1; mGXII-1-PLA2; 2310004B05Rik; MGC58884; |
| Gene ID | 66350 |
| mRNA Refseq | NM_023196 |
| Protein Refseq | NP_075685 |
| ◆ Recombinant Proteins | ||
| Pla2g12a-8261M | Recombinant Mouse Pla2g12a protein, His & T7-tagged | +Inquiry |
| PLA2G12A-3452R | Recombinant Rhesus monkey PLA2G12A Protein, His-tagged | +Inquiry |
| PLA2G12A-72H | Recombinant Human Phospholipase A2, Group XIIA, His-tagged | +Inquiry |
| PLA2G12A-2337H | Recombinant Human PLA2G12A protein, His&Myc-tagged | +Inquiry |
| PLA2G12A-4793M | Recombinant Mouse PLA2G12A protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLA2G12A-482HCL | Recombinant Human PLA2G12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pla2g12a Products
Required fields are marked with *
My Review for All Pla2g12a Products
Required fields are marked with *
