Recombinant Mouse Plet1 Protein, His-SUMO-tagged
| Cat.No. : | Plet1-1329M |
| Product Overview : | Recombinant Mouse Plet1 Protein (28-218aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 28-218 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 36.1 kDa |
| AA Sequence : | SDNGSCVVLDNIYTSDILEISTMANVSGGDVTYTVTVPVNDSVSAVILKAVKEDDSPVGTWSGTYEKCND SSVYYNLTSQSQSVFQTNWTVPTSEDVTKVNLQVLIVVNRTASKSSVKMEQVQPSASTPIPESSETSQTI NTTPTVNTAKTTAKDTANTTAVTTANTTANTTAVTTAKTTAKSLAIRTLGS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Plet1 placenta expressed transcript 1 [ Mus musculus (house mouse) ] |
| Official Symbol | Plet1 |
| Synonyms | AA407923; AU043048; 0610037B23Rik; 1600029D21Rik; Plet1 |
| Gene ID | 76509 |
| mRNA Refseq | NM_029639.2 |
| Protein Refseq | NP_083915.2 |
| UniProt ID | Q8VEN2 |
| ◆ Recombinant Proteins | ||
| Plet1-1329M | Recombinant Mouse Plet1 Protein, His-SUMO-tagged | +Inquiry |
| Plet1-2433M | Recombinant Mouse Plet1 protein, His-tagged | +Inquiry |
| RFL8413BF | Recombinant Full Length Bovine Placenta-Expressed Transcript 1 Protein(Plet1) Protein, His-Tagged | +Inquiry |
| PLET1-4571H | Recombinant Human PLET1 protein, His-tagged | +Inquiry |
| PLET1-2321H | Recombinant Human PLET1 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Plet1 Products
Required fields are marked with *
My Review for All Plet1 Products
Required fields are marked with *
