Recombinant Mouse Pou5f1, Arg-tagged
| Cat.No. : | Pou5f1-164M |
| Product Overview : | Recombinant Mouse Oct-3/4-polyR is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asn352) of Mouse OCT4 fused with a polyarginine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 1-352 a.a. |
| Description : | Octamer-Binding Protein 4 (Oct4) is a homeodomain transcription factor of the POU family and can be expressed in embryonic stem cells and embryonic carcinoma cells. Oct 4 is critically involved in the signaling pathway for maintaining self-renewal and pluripotency of embryonic stem cells. Oct4 binds to the octamer motif to form a trimeric complex with SOX2 on DNA and controls the expression of many genes involved in embryonic development, such as YES1, FGF4, UTF1, ZFP206. Oct4 can regulate SOX2 and Nanog to support stem cell potency and self-renewal. The transcriptional activity can be positively regulated by PKM2. |
| AA Sequence : | MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLGISPCPPAYEFC GGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLEKVEPTPEESQ DMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRP LLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQL GLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPGGAVSFPLPPGPHFGTPGYGSPHFTT LYSVPFPEGEAFPSVPVTALGSPMHSN |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | Pou5f1 POU domain, class 5, transcription factor 1 [ Mus musculus ] |
| Official Symbol | Pou5f1 |
| Synonyms | POU5F1; POU domain, class 5, transcription factor 1; octamer-binding protein 3; octamer-binding protein 4; octamer-binding transcription factor 3; Oct3; Oct4; Otf3; Otf4; NF-A3; Oct-3; Oct-4; Otf-3; Otf-4; Otf3g; Oct3/4; Oct-3/4; Otf3-rs7; |
| Gene ID | 18999 |
| mRNA Refseq | NM_001252452 |
| Protein Refseq | NP_001239381 |
| Pathway | PluriNetWork, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; |
| Function | DNA binding; DNA binding; DNA binding; chromatin binding; miRNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding; sequence-specific DNA binding RNA polymerase II transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription corepressor activity; transcription factor binding; transcription factor binding; transcription regulatory region DNA binding; transcription regulatory region DNA binding; ubiquitin protein ligase binding; ubiquitin protein ligase binding; |
| ◆ Recombinant Proteins | ||
| Pou5f1-200M | Recombinant Mouse Pou5f1, TAT-tagged | +Inquiry |
| POU5F1-3631H | Recombinant Full Length Human POU Class 5 Homeobox 1/POU5F1 Protein | +Inquiry |
| POU5F1-639H | Recombinant Human POU5F1 Protein, His-tagged | +Inquiry |
| POU5F1-5938H | Recombinant Human POU5F1 Protein (Ser136-Ser289), N-His tagged | +Inquiry |
| POU5F1-116H | Recombinant Human POU5F1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POU5F1-2999HCL | Recombinant Human POU5F1 293 Cell Lysate | +Inquiry |
| POU5F1-3000HCL | Recombinant Human POU5F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pou5f1 Products
Required fields are marked with *
My Review for All Pou5f1 Products
Required fields are marked with *



