Recombinant Mouse Ptges Full Length Transmembrane protein, His-SUMO-tagged

Cat.No. : Ptges-483M
Product Overview : Recombinant Mouse Ptges protein(Q9JM51)(1-153aa), fused with N-terminal His-SUMO tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 1-153aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence : MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYY RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG KLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Ptges prostaglandin E synthase [ Mus musculus ]
Official Symbol Ptges
Synonyms PTGES; prostaglandin E synthase; microsomal prostaglandin E synthase 1; Pges; mPGES; mPGES-1; D2Ertd369e; 2410099E23Rik;
Gene ID 64292
mRNA Refseq NM_022415
Protein Refseq NP_071860

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ptges Products

Required fields are marked with *

My Review for All Ptges Products

Required fields are marked with *

0
cart-icon
0
compare icon