Recombinant Mouse Ptges Full Length Transmembrane protein, His-SUMO-tagged
Cat.No. : | Ptges-483M |
Product Overview : | Recombinant Mouse Ptges protein(Q9JM51)(1-153aa), fused with N-terminal His-SUMO tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-153aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
AA Sequence : | MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYY RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG KLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Ptges prostaglandin E synthase [ Mus musculus ] |
Official Symbol | Ptges |
Synonyms | PTGES; prostaglandin E synthase; microsomal prostaglandin E synthase 1; Pges; mPGES; mPGES-1; D2Ertd369e; 2410099E23Rik; |
Gene ID | 64292 |
mRNA Refseq | NM_022415 |
Protein Refseq | NP_071860 |
◆ Recombinant Proteins | ||
PTGES-145H | Recombinant Human PTGES Protein, His/GST-tagged | +Inquiry |
RFL27653MF | Recombinant Full Length Mouse Prostaglandin E Synthase(Ptges) Protein, His-Tagged | +Inquiry |
Ptges-1999R | Recombinant Rat Ptges Protein, His-tagged | +Inquiry |
PTGES-1247H | Recombinant Full Length Human PTGES Protein (M1-L152 end), His tagged | +Inquiry |
PTGES-3312H | Recombinant Full Length Human PTGES Protein (Met1-Leu152), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGES-2715HCL | Recombinant Human PTGES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ptges Products
Required fields are marked with *
My Review for All Ptges Products
Required fields are marked with *
0
Inquiry Basket