Recombinant Mouse Ramp3 protein, His-tagged

• Cat.No.: Ramp3-4720M
• Product Overview: Recombinant Mouse Ramp3 protein(Q9WUP1-2)(23-117 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 23-117 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 12.6 kDa
• AASequence: QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Ramp3 receptor (calcitonin) activity modifying protein 3 [ Mus musculus ]
• Official Symbol: Ramp3
• Synonyms: RAMP3; receptor (calcitonin) activity modifying protein 3; receptor activity-modifying protein 3; AI850306
• Gene ID: 56089
• mRNA Refseq: NM_019511
• Protein Refseq: NP_062384