Recombinant Mouse Ramp3 protein, His-tagged
Cat.No. : | Ramp3-4720M |
Product Overview : | Recombinant Mouse Ramp3 protein(Q9WUP1-2)(23-117 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 23-117 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 12.6 kDa |
AASequence : | QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Ramp3 receptor (calcitonin) activity modifying protein 3 [ Mus musculus ] |
Official Symbol | Ramp3 |
Synonyms | RAMP3; receptor (calcitonin) activity modifying protein 3; receptor activity-modifying protein 3; AI850306; |
Gene ID | 56089 |
mRNA Refseq | NM_019511 |
Protein Refseq | NP_062384 |
◆ Recombinant Proteins | ||
RAMP3-8607H | Recombinant Human RAMP3, Fc tagged | +Inquiry |
RAMP3-4921R | Recombinant Rat RAMP3 Protein | +Inquiry |
RAMP3-1343H | Recombinant Human RAMP3 protein(Met1-Val118), hFc-tagged | +Inquiry |
RAMP3-3596R | Recombinant Rhesus Macaque RAMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25419HF | Recombinant Full Length Human Receptor Activity-Modifying Protein 3(Ramp3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAMP3-1214HCL | Recombinant Human RAMP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ramp3 Products
Required fields are marked with *
My Review for All Ramp3 Products
Required fields are marked with *