Recombinant Mouse Rbp4 protein(19-201aa), hFc-tagged

• Cat.No.: Rbp4-2928M
• Product Overview: Recombinant Mouse Rbp4 protein(Q00724)(19-201aa), fused with C-terminal hFc tag, was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Protein Length: 19-201aa
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.
• Molecular Mass: 50.3 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Gene Information

• Gene Name: Rbp4 retinol binding protein 4, plasma [ Mus musculus ]
• Official Symbol: Rbp4
• Synonyms: RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol binding protein 4, cellular; Rbp-4
• Gene ID: 19662
• mRNA Refseq: NM_001159487
• Protein Refseq: NP_001152959