Recombinant Mouse Rbp4 protein(19-201aa), hFc-tagged
Cat.No. : | Rbp4-2928M |
Product Overview : | Recombinant Mouse Rbp4 protein(Q00724)(19-201aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 19-201aa |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL. |
Molecular Mass : | 50.3 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL |
Gene Name | Rbp4 retinol binding protein 4, plasma [ Mus musculus ] |
Official Symbol | Rbp4 |
Synonyms | RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol binding protein 4, cellular; Rbp-4; |
Gene ID | 19662 |
mRNA Refseq | NM_001159487 |
Protein Refseq | NP_001152959 |
◆ Recombinant Proteins | ||
RBP4-1421HFL | Recombinant Full Length Human RBP4 Protein, C-Flag-tagged | +Inquiry |
Rbp4-448R | Recombinant Rat Rbp4, His-tagged | +Inquiry |
RBP4-781H | Recombinant Human RBP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBP4-6159H | Recombinant Human RBP4 Protein (Ala18-Leu201), N-His tagged | +Inquiry |
RBP4-1036C | Active Recombinant Canine RBP4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
RBP4-2271RCL | Recombinant Rat RBP4 cell lysate | +Inquiry |
RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rbp4 Products
Required fields are marked with *
My Review for All Rbp4 Products
Required fields are marked with *
0
Inquiry Basket