Recombinant Mouse Retnla Protein
| Cat.No. : | Retnla-236M |
| Product Overview : | Recombinant Mouse Retnla Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Resistin-like molecule-alpha (RELM-α) is a member of the RELM family of secreted proteins containing conserved C-terminus cysteines. The RELM family consists of Resistin (FIZZ3), RELM-α (FIZZ1), RELM-β (FIZZ2), and RELM-γ (FIZZ4). RELM-α and Resistin are secreted by adipocytes, unlike RELM-β which is secreted by gastrointestinal epithelial cells, and RELM-γ which is expressed by peripheal blood granulocytes and bone marrow cells. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 9.6 kDa (89 aa) |
| AA Sequence : | MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | Retnla resistin like alpha [ Mus musculus (house mouse) ] |
| Official Symbol | Retnla |
| Synonyms | RETNLA; resistin like alpha; resistin-like alpha; found in inflammatory zone 1; hypoxia-induced mitogenic factor; cysteine-rich secreted protein FIZZ1; cysteine-rich secreted protein A12-gamma; parasite-induced macrophage novel gene 1 protein; HIMF; Xcp2; Fizz1; RELMa; Fizz-1; RELMalpha; RELM-alpha; 1810019L16Rik; |
| Gene ID | 57262 |
| mRNA Refseq | NM_020509 |
| Protein Refseq | NP_065255 |
| UniProt ID | Q9EP95 |
| ◆ Recombinant Proteins | ||
| Retnla-5468M | Recombinant Mouse Retnla Protein | +Inquiry |
| Retnla-4746M | Recombinant Mouse Resistin Like Alpha | +Inquiry |
| Retnla-6849R | Recombinant Rat Retnla Protein (Met1-Ser111), C-Fc tagged | +Inquiry |
| Retnla-236M | Recombinant Mouse Retnla Protein | +Inquiry |
| Retnla-998M | Recombinant Murine Resistin Like Beta | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retnla Products
Required fields are marked with *
My Review for All Retnla Products
Required fields are marked with *
