Recombinant Mouse Retnlg Protein
Cat.No. : | Retnlg-5471M |
Product Overview : | Purified recombinant protein of Mouse resistin like gamma (Retnlg) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Probable hormone (Probable). Promotes chemotaxis in myeloid cells. |
Molecular Mass : | 9.2 kDa |
AA Sequence : | EGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Unopened vial can be stored between 2 and 8 centigrade for up to 2 weeks, at -20 centigrade for up to 6 months, or at -70 centigrade or below until the expiration date. Aliquots can be stored between 2 and 8 centigrade for up to one week and stored at -20 centigrade or colder for up to 3 months. Avoid repeated freeze/thaw cycles. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Retnlg resistin like gamma [ Mus musculus (house mouse) ] |
Official Symbol | Retnlg |
Synonyms | RETNLG; resistin like gamma; resistin-like gamma; RELMgamma; resistin-like molecule gamma; Xcp1; Fizz3; Relmg |
Gene ID | 245195 |
mRNA Refseq | NM_181596 |
Protein Refseq | NP_853627 |
UniProt ID | Q8K426 |
◆ Recombinant Proteins | ||
Retnlg-122M | Recombinant Mouse resistin like gamma, His-tagged | +Inquiry |
Retnlg-5471M | Recombinant Mouse Retnlg Protein | +Inquiry |
Retnlg-3716M | Recombinant Mouse Retnlg, His-tagged | +Inquiry |
Retnlg-239M | Recombinant Mouse Retnlg Protein | +Inquiry |
Retnlg-1051M | Recombinant Mouse Retnlg Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retnlg Products
Required fields are marked with *
My Review for All Retnlg Products
Required fields are marked with *