Recombinant Mouse Retnlg Protein

• Cat.No.: Retnlg-5471M
• Product Overview: Purified recombinant protein of Mouse resistin like gamma (Retnlg) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Probable hormone (Probable). Promotes chemotaxis in myeloid cells.
• Molecular Mass: 9.2 kDa
• AA Sequence: EGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Unopened vial can be stored between 2 and 8 centigrade for up to 2 weeks, at -20 centigrade for up to 6 months, or at -70 centigrade or below until the expiration date. Aliquots can be stored between 2 and 8 centigrade for up to one week and stored at -20 centigrade or colder for up to 3 months. Avoid repeated freeze/thaw cycles.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Retnlg resistin like gamma [ Mus musculus (house mouse) ]
• Official Symbol: Retnlg
• Synonyms: RETNLG; resistin like gamma; resistin-like gamma; RELMgamma; resistin-like molecule gamma; Xcp1; Fizz3; Relmg
• Gene ID: 245195
• mRNA Refseq: NM_181596
• Protein Refseq: NP_853627
• UniProt ID: Q8K426