Recombinant Mouse Retnlg Protein

Cat.No. : Retnlg-239M
Product Overview : Recombinant Mouse Retnlg Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Resistin-like molecule-gamma (RELM-
Bio-activity : No biological activity data is available at this time.
AA Sequence : MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution:
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Gene Name Retnlg resistin like gamma [ Mus musculus (house mouse) ]
Official Symbol Retnlg
Synonyms RETNLG; resistin like gamma; resistin-like gamma; RELMgamma; resistin-like molecule gamma; Xcp1; Fizz3; Relmg;
Gene ID 245195
mRNA Refseq NM_181596
Protein Refseq NP_853627
UniProt ID Q8K426

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Retnlg Products

Required fields are marked with *

My Review for All Retnlg Products

Required fields are marked with *

0

Inquiry Basket

cartIcon