Recombinant Mouse Retnlg Protein

• Cat.No.: Retnlg-239M
• Product Overview: Recombinant Mouse Retnlg Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Resistin-like molecule-gamma (RELM-
• Bio-activity: No biological activity data is available at this time.
• AA Sequence: MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: Retnlg resistin like gamma [ Mus musculus (house mouse) ]
• Official Symbol: Retnlg
• Synonyms: RETNLG; resistin like gamma; resistin-like gamma; RELMgamma; resistin-like molecule gamma; Xcp1; Fizz3; Relmg
• Gene ID: 245195
• mRNA Refseq: NM_181596
• Protein Refseq: NP_853627
• UniProt ID: Q8K426