Recombinant Mouse Retnlg Protein
Cat.No. : | Retnlg-239M |
Product Overview : | Recombinant Mouse Retnlg Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Resistin-like molecule-gamma (RELM- |
Bio-activity : | No biological activity data is available at this time. |
AA Sequence : | MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | Retnlg resistin like gamma [ Mus musculus (house mouse) ] |
Official Symbol | Retnlg |
Synonyms | RETNLG; resistin like gamma; resistin-like gamma; RELMgamma; resistin-like molecule gamma; Xcp1; Fizz3; Relmg; |
Gene ID | 245195 |
mRNA Refseq | NM_181596 |
Protein Refseq | NP_853627 |
UniProt ID | Q8K426 |
◆ Recombinant Proteins | ||
Retnlg-3716M | Recombinant Mouse Retnlg, His-tagged | +Inquiry |
Retnlg-5471M | Recombinant Mouse Retnlg Protein | +Inquiry |
Retnlg-1051M | Recombinant Mouse Retnlg Protein | +Inquiry |
Retnlg-239M | Recombinant Mouse Retnlg Protein | +Inquiry |
Retnlg-122M | Recombinant Mouse resistin like gamma, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retnlg Products
Required fields are marked with *
My Review for All Retnlg Products
Required fields are marked with *