Recombinant Mouse Rtn3 protein, His-tagged
Cat.No. : | Rtn3-6474M |
Product Overview : | Recombinant Mouse Rtn3 protein(Q9ES97)(182-440aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 182-440aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KDQEPKNPNKVPDGEDRSALDFGQSKAEHICTYSLSPSELPVASVEKDSPESPFEVIIDKATFDREFKDLYKENPNDLGGWAAHGDRESPADLLEMNDKLFPLRNKEAGRYPSSVLLGRQFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQANKTSCTTESTGLDRSELRSEIPVINLKTNPQQKMPVCSFNGSTPITKSTGDWTEAFTEGKPVRDYLSSTKEAGGNGVPGSSQLHSELPGSMPEKWVSGSGA |
Gene Name | Rtn3 reticulon 3 [ Mus musculus ] |
Official Symbol | Rtn3 |
Synonyms | RTN3; reticulon 3; reticulon-3; Nsp-like II; RTN3-A1; AW558451; MGC105197; |
Gene ID | 20168 |
mRNA Refseq | NM_001003933 |
Protein Refseq | NP_001003933 |
◆ Recombinant Proteins | ||
Rtn3-5633M | Recombinant Mouse Rtn3 protein, His-tagged | +Inquiry |
RTN3-11298Z | Recombinant Zebrafish RTN3 | +Inquiry |
RFL7004XF | Recombinant Full Length Xenopus Tropicalis Reticulon-3(Rtn3) Protein, His-Tagged | +Inquiry |
Rtn3-6474M | Recombinant Mouse Rtn3 protein, His-tagged | +Inquiry |
RTN3-5194R | Recombinant Rat RTN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTN3-2122HCL | Recombinant Human RTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rtn3 Products
Required fields are marked with *
My Review for All Rtn3 Products
Required fields are marked with *
0
Inquiry Basket