Recombinant Mouse S100a3 Protein, His-tagged

• Cat.No.: S100a3-7321M
• Product Overview: Recombinant mouse S100A3 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-101
• Description: Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
• Form: Liquid
• Molecular Mass: 14.3 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer, pH 8.0, 10 % glycerol, 2 mM DTT, 150 mM NaCl

Gene Information

• Gene Name: S100a3 S100 calcium binding protein A3 [ Mus musculus (house mouse) ]
• Official Symbol: S100a3
• Synonyms: S100a3; S100 calcium binding protein A3; S100; S100E; protein S100-A3
• Gene ID: 20197
• mRNA Refseq: NM_001355597
• Protein Refseq: NP_001342526
• UniProt ID: P62818