Recombinant Mouse S100a3 Protein, His-tagged
Cat.No. : | S100a3-7321M |
Product Overview : | Recombinant mouse S100A3 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-101 |
Description : | Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation. |
Form : | Liquid |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer, pH 8.0, 10 % glycerol, 2 mM DTT, 150 mM NaCl |
Gene Name | S100a3 S100 calcium binding protein A3 [ Mus musculus (house mouse) ] |
Official Symbol | S100a3 |
Synonyms | S100a3; S100 calcium binding protein A3; S100; S100E; protein S100-A3 |
Gene ID | 20197 |
mRNA Refseq | NM_001355597 |
Protein Refseq | NP_001342526 |
UniProt ID | P62818 |
◆ Recombinant Proteins | ||
S100a3-6962M | Recombinant Mouse S100 Calcium Binding Protein A3, His-tagged | +Inquiry |
S100A3-3613H | Recombinant Human S100A3 protein, His-tagged | +Inquiry |
S100A3-1654HFL | Recombinant Full Length Human S100A3 Protein, C-Flag-tagged | +Inquiry |
S100A3-3279H | Recombinant Human S100A3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A3-5212R | Recombinant Rat S100A3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a3 Products
Required fields are marked with *
My Review for All S100a3 Products
Required fields are marked with *
0
Inquiry Basket