Recombinant Mouse S100a7a Protein, His-tagged

Cat.No. : S100a7a-7392M
Product Overview : Recombinant mouse S100A15 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-108
Description : Biased expression in bladder adult (RPKM 1.5), lung adult (RPKM 0.7) and 13 other tissues
Form : Liquid
Molecular Mass : 15 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY
Purity : > 85 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 20 % glycerol
Gene Name S100a7a S100 calcium binding protein A7A [ Mus musculus (house mouse) ]
Official Symbol S100a7a
Synonyms S100a7a; S100 calcium binding protein A7A; S100A; Gm1020; S100a1; S100A7f; S100a15; AY465109; S100A7L1; S100a15a; S100a17l1; protein S100-A15A; S100 calcium binding protein A15; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A15A
Gene ID 381493
mRNA Refseq NM_199422
Protein Refseq NP_955454
UniProt ID Q6S5I3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a7a Products

Required fields are marked with *

My Review for All S100a7a Products

Required fields are marked with *

0
cart-icon