Recombinant Mouse Saa3 Protein, His-tagged

Cat.No. : Saa3-1455M
Product Overview : Recombinant Mouse Saa3(20-122aa) fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 20-122aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 15.8kDa
AA Sequence : RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Saa3 serum amyloid A 3 [ Mus musculus ]
Official Symbol Saa3
Synonyms l7R3; Saa-3; AV098916
Gene ID 20210
mRNA Refseq NM_011315
Protein Refseq NP_035445
UniProt ID P04918

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Saa3 Products

Required fields are marked with *

My Review for All Saa3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon