Recombinant Mouse Saa3 Protein, His-tagged

• Cat.No.: Saa3-1455M
• Product Overview: Recombinant Mouse Saa3(20-122aa) fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 20-122aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 15.8kDa
• AA Sequence: RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Saa3 serum amyloid A 3 [ Mus musculus ]
• Official Symbol: Saa3
• Synonyms: l7R3; Saa-3; AV098916
• Gene ID: 20210
• mRNA Refseq: NM_011315
• Protein Refseq: NP_035445
• UniProt ID: P04918