Recombinant Mouse Saa3 Protein, His-tagged
Cat.No. : | Saa3-1455M |
Product Overview : | Recombinant Mouse Saa3(20-122aa) fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-122aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 15.8kDa |
AA Sequence : | RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Saa3 serum amyloid A 3 [ Mus musculus ] |
Official Symbol | Saa3 |
Synonyms | l7R3; Saa-3; AV098916 |
Gene ID | 20210 |
mRNA Refseq | NM_011315 |
Protein Refseq | NP_035445 |
UniProt ID | P04918 |
◆ Recombinant Proteins | ||
Saa3-1455M | Recombinant Mouse Saa3 Protein, His-tagged | +Inquiry |
SAA3-7878M | Recombinant Mouse SAA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAA3-14635M | Recombinant Mouse SAA3 Protein | +Inquiry |
Saa3-1456M | Recombinant Mouse Saa3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Saa3 Products
Required fields are marked with *
My Review for All Saa3 Products
Required fields are marked with *
0
Inquiry Basket