Recombinant Mouse Scd1 protein, His&Myc-tagged
Cat.No. : | Scd1-3861M |
Product Overview : | Recombinant Mouse Scd1 protein(P13516)(260-355aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 260-355aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.4 kDa |
AA Sequence : | VNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Scd1 stearoyl-Coenzyme A desaturase 1 [ Mus musculus ] |
Official Symbol | Scd1 |
Synonyms | SCD1; stearoyl-Coenzyme A desaturase 1; acyl-CoA desaturase 1; asebia; delta-9 desaturase 1; delta(9)-desaturase 1; fatty acid desaturase 1; stearoyl-CoA desaturase 1; ab; Scd; Scd-1; AA589638; AI265570; |
Gene ID | 20249 |
mRNA Refseq | NM_009127 |
Protein Refseq | NP_033153 |
◆ Recombinant Proteins | ||
RFL13793MF | Recombinant Full Length Mouse Acyl-Coa Desaturase 1(Scd1) Protein, His-Tagged | +Inquiry |
Scd1-3127M | Recombinant Mouse Scd1, His-tagged | +Inquiry |
Scd1-111M | Recombinant Mouse Scd1 Full Length Transmembrane protein, His-tagged | +Inquiry |
SCD1-7927M | Recombinant Mouse SCD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCD1-4906R | Recombinant Rat SCD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Scd1 Products
Required fields are marked with *
My Review for All Scd1 Products
Required fields are marked with *
0
Inquiry Basket