Recombinant Mouse Scd1 protein, His&Myc-tagged
| Cat.No. : | Scd1-3861M |
| Product Overview : | Recombinant Mouse Scd1 protein(P13516)(260-355aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 260-355aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.4 kDa |
| AA Sequence : | VNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Scd1 stearoyl-Coenzyme A desaturase 1 [ Mus musculus ] |
| Official Symbol | Scd1 |
| Synonyms | SCD1; stearoyl-Coenzyme A desaturase 1; acyl-CoA desaturase 1; asebia; delta-9 desaturase 1; delta(9)-desaturase 1; fatty acid desaturase 1; stearoyl-CoA desaturase 1; ab; Scd; Scd-1; AA589638; AI265570; |
| Gene ID | 20249 |
| mRNA Refseq | NM_009127 |
| Protein Refseq | NP_033153 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Scd1 Products
Required fields are marked with *
My Review for All Scd1 Products
Required fields are marked with *
